missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CKS2 (Human) Recombinant Protein
Human CKS2 full-length ORF ( AAH06458, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00001164-P01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Specifications
| AAH06458 | |
| CDC28 protein kinase regulatory subunit 2 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CKS2 | |
| GST |
| 1164 | |
| Wheat germ expression system | |
| 10 μg | |
| CKSHS2 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |