Learn More
Abnova™ CKM Recombinant Protein
Human CKM full-length ORF recombinant protein with GST-tag at N-terminal
Brand: Abnova™ H00001158-P01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family.
- Theoretical MW (kDa): 67.65
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDCHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLAGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
Antibody Production, ELISA, Protein Array, Western Blot | |
67.7 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25μg | |
-80°C | |
Recombinant |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
Human CKM Full-length ORF Recombinant Protein with GST-tag at N-terminal | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE stained with Coomassie Blue | |
Wheat Germ (in vitro) | |
Human | |
Solution |