missing translation for 'onlineSavingsMsg'
Learn More

CKAP2 Recombinant Protein, Abnova

Brand:  Abnova H00026586-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138402

  • 5420.23 NOK / 25µg

Estimated Shipment: 07-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH10901.1
Solution
26586
CKAP2 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CKAP2
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
43.8
8
Glutathione Sepharose 4 Fast Flow
25 ug
MEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILAGAQVR
DKFZp686L1238/FLJ10749/LB1/TMAP/se20-10
CKAP2
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates