missing translation for 'onlineSavingsMsg'
Learn More

CHMP2A Recombinant Protein, Abnova

Brand:  Abnova H00027243-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138692

  • 3602.46 NOK / 10µg

Estimated Shipment: 26-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

NP_055268
Solution
27243
CHMP2A (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CHMP2A
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
50.4
8
Glutathione Sepharose 4 Fast Flow
10 ug
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD
BC-2/BC2/CHMP2/VPS2/VPS2A
CHMP2A
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates