missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CD14 (Human) Recombinant Protein

Human CD14 full-length ORF ( AAH10507, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000929-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16142811

  • 4130.00 NOK / 10µg
Estimated Shipment: 15-11-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQDLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Specifications

Specifications

AAH10507
CD14 molecule
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
929
Wheat germ expression system
10 μg
CD14
GST
Videos
SDS
Documents
Product Certifications
Special Offers

Special Offers