missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30499889

CBFA2T3 Antibody [Janelia Fluor« 525], Novus Biologicals Biologicals™

Product Code. 30499889 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30499889 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30499889 Supplier Novus Biologicals Supplier No. NBP335460JF525

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CBFA2T3 Polyclonal antibody specifically detects CBFA2T3 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen CBFA2T3
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Janelia Fluor 525
Formulation 50mM Sodium Borate
Gene Alias core-binding factor, runt domain, alpha subunit 2; translocated to, 3, hMTG16, MTG16ETO2, MTG8-related protein 2, MTGR2MTG8-related gene 2, Myeloid translocation gene on chromosome 16 protein, protein CBFA2T3, Zinc finger MYND domain-containing protein 4, ZMYND4myeloid translocation gene 8 and 16b
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 593-653 of human CBFA2T3 (NP_005178.4).,, Sequence:, DRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMAHHFRDAYRHPDPRELRERHRPLVVPGSRQEEVIDHKLTER
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 863
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.