missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C21orf91 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3571.05 NOK - 5364.45 NOK
Specifications
| Antigen | C21orf91 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18208884
|
Novus Biologicals
NBP2-55022 |
100 μL |
5675.00 NOK 5364.45 NOK / 100µL Save 310.55 NOK 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18615417
|
Novus Biologicals
NBP2-55022-25ul |
25 μL |
3780.00 NOK 3571.05 NOK / 25µL Save 208.95 NOK 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
C21orf91 Polyclonal specifically detects C21orf91 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| C21orf91 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C21orf14, C21orf38, C21orf7, chromosome 21 open reading frame 38, chromosome 21 open reading frame 91, CSSG1, DKFZp781D1223, early undifferentiated retina and lens, EURL, protein EURL homolog, YG81, YG81C21orf14 | |
| C21ORF91 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 54149 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EEEQFVNIDLNDDNICSVCKLGTDKETLSFCHICFELNIEGVPKSDLLHTKSLRGHKDCFEKYHLIANQGCPRSKLS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title