missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ARHGDIB (Human) Recombinant Protein

Human ARHGDIB full-length ORF ( AAH09200, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000397-P01.10ug

Additional Details : Weight : 0.00010kg


 View more versions of this product

Product Code. 16191861

  • 3655.00 NOK / 10µg
Estimated Shipment: 27-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Specifications

Specifications

AAH09200
Rho GDP dissociation inhibitor (GDI) beta
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARHGDIB
GST
397
Wheat germ expression system
10 μg
D4, GDIA2, GDID4, LYGDI, Ly-GDI, RAP1GN1, RhoGDI2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Safety and Handling

Safety and Handling

Product Identifier
  • ARHGDIB (Human) Recombinant Protein (P01)

Signal Word
  • Warning

Hazard Category
  • Acute toxicity Category 4
  • Serious eye damage/eye irritation Category 2
  • Skin corrosion/irritation Category 2

Hazard Statement
  • H302-Harmful if swallowed.
  • H315-Causes skin irritation.
  • H319-Causes serious eye irritation.

Precautionary Statement
  • P102-Keep out of reach of children.
  • P103-Read label before use.
  • P233-Keep container tightly closed.
  • P264-Wash hands thoroughly after handling.
  • P270-Do not eat, drink or smoke when using this product.
  • P280-Wear protective gloves/protective clothing/eye protection/face protection.
  • P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
  • P304+P340-IF INHALED: Remove person to fresh air and keep comfortable for breathing.
  • P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
  • P404-Store in a closed container.
  • P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.

Supplemental information
  • MIXTURE LIST-Contains : Tris-HCl, Reduced Glutathione

SDS
Documents

Documents

Certificates
Special Offers

Special Offers