missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin 1/AQP1 Antibody [mFluor Violet 500 SE], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
Aquaporin 1/AQP1 Polyclonal antibody specifically detects Aquaporin 1/AQP1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | Aquaporin 1/AQP1 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | mFluor Violet 500 SE |
| Formulation | 50mM Sodium Borate |
| Gene Alias | 28-kDa, AQP-1, AQP-CHIP, aquaporin 1 (channel-forming integral protein, 28kDa), aquaporin 1 (Colton blood group), Aquaporin-CHIP, CHIP2828kDa, CO blood group), CO, MGC26324 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-269 of human Aquaporin 1/AQP1 (AQP1) (NP_932766.1).,, Sequence:, AVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?