missing translation for 'onlineSavingsMsg'
Learn More

NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase), Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human NDUFS6 protein.

Brand: Abnova H00004726-B01P.50ug

Product Code. 16181775

4785.00 NOK
3957.94 NOK / 50µg
Save 827.06 NOK
17% Off

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

The multisubunit NADH:ubiquinone oxidoreductase (complex I) is the first enzyme complex in the electron transport chain of mitochondria. The iron-sulfur protein (IP) fraction is made up of 7 subunits, including NDUFS6. See NDUFS1 (MIM 157655).[supplied by OMIM

Sequence: MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH

Specifications

Antigen	NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase)
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a full-length human NDUFS6 protein.
Gene	NDUFS6
Gene Symbols	NDUFS6
Immunogen	NDUFS6 (NP_004544.1, 1 a.a. ∼ 124 a.a) full-length human protein.
Quantity	50 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_004553.3
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	4726
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase), Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions