missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GATA binding protein 6, Mouse, Polyclonal Antibody, Abnova™
Description
Sequence: KNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA
Specifications
Specifications
| Antigen | GATA binding protein 6 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Description | Mouse polyclonal antibody raised against a partial recombinant GATA6. |
| Formulation | 50% glycerol |
| Gene | GATA6 |
| Gene Accession No. | NM_005257 |
| Gene Symbols | GATA6 |
| Host Species | Mouse |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?