missing translation for 'onlineSavingsMsg'
Learn More

collagen triple helix repeat containing 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CTHRC1.

Brand: Abnova H00115908-A01.50uL

Product Code. 16181497

3315.00 NOK
2742.82 NOK / 50µL
Save 572.18 NOK
17% Off

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

CTHRC1 is specifically expressed in vascular calcifications of carotid artery lesions and may contribute to vascular remodeling of injured arteries (Pyagay et al., 2005 [PubMed 15618538]).[supplied by OMIM

Sequence: EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF

Specifications

Antigen	collagen triple helix repeat containing 1
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant CTHRC1.
Gene	CTHRC1
Gene Symbols	CTHRC1
Immunogen	CTHRC1 (NP_612464, 32 a.a. ∼ 141 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	115908
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_138455
Host Species	Mouse
Quantity	50 μL
Research Discipline	Cell Adhesion
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

collagen triple helix repeat containing 1, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions