missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ANO6 Antibody - Azide and BSA Free, Novus Biologicals™

ANO6 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18645210 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.10mL
Product Code. Quantity unitSize
18645210 0.02 mL 0.02mL
18650671 0.1 mL 0.10mL
2 options
This item is not returnable. View return policy

Product Code. 18645210

Brand: Novus Biologicals NBP2920520.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ANO6 Polyclonal antibody specifically detects ANO6 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen ANO6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias anoctamin 6, anoctamin-6, MGC104751, Transmembrane protein 16FTMEM16FDKFZp313M0720
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 750-830 of human ANO6 (NP_001020527.2). IPRLVYYWSFSVPPYGDHTSYTMEGYINNTLSIFKVADFKNKSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHV
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 196527
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.