missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ AMBP (Human) Recombinant Protein

Human AMBP full-length ORF ( AAH41593, 19 a.a. - 352 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000259-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16141531

  • 3602.46 NOK / 10µg

Estimated Shipment: 30-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN
Specifications

Specifications

AAH41593
alpha-1-microglobulin/bikunin precursor
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AMBP
GST
259
Wheat germ expression system
10 μg
EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates