missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alpha-Galactosidase A/GLA Rabbit anti-Human, Mouse, Rat, Clone: 7G8T9, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-16563-20UL
This item is not returnable.
View return policy
Description
alpha-Galactosidase A/GLA Monoclonal antibody specifically detects alpha-Galactosidase A/GLA in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| alpha-Galactosidase A/GLA | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot | |
| 7G8T9 | |
| Western Blot 1:500 - 1:2000 | |
| Agalsidase, agalsidase alfa, Alpha-D-galactosidase A, Alpha-D-galactoside galactohydrolase, alpha-D-galactoside galactohydrolase 1, alpha-gal A, alpha-galactosidase A, EC 3.2.1, EC 3.2.1.22, GALA, galactosidase, alpha, melibiase | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human alpha-Galactosidase A/GLA (GLA) (P06280). FMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFG | |
| 20 μg | |
| Cardiovascular Biology | |
| 2717 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction