missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ AK2 Recombinant Protein

Human AK2 full-length ORF recombinant protein with GST-tag at N-terminal

Brand:  Abnova™ H00000204-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16191411

  • 5540.00 NOK / 25µg
Estimated Shipment: 23-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Two transcript variants encoding distinct isoforms have been identified for this gene.

  • Theoretical MW (kDa): 52.03
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT
QTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

Antibody Production, ELISA, Protein Array, Western Blotting (Recombinant Protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Human AK2 Full-length ORF Recombinant Protein with GST-tag at N-terminal
In vitro wheat germ expression system
12.5% SDS-PAGE stained with Coomassie Blue
Wheat Germ (in vitro)
Human
Solution
52.03
8
Glutathione Sepharose 4 Fast Flow
25μg
-80°C
Yes
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers