missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18232613

Novus Biologicals™ AGXT2L2 Recombinant Protein Antigen

Product Code. 18232613 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18232613 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18232613 Supplier Novus Biologicals™ Supplier No. NBP257386PEP
 Restricted Item
Estimated Shipment: 14-10-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGXT2L2. Source: E.coli Amino Acid Sequence: VLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGV The AGXT2L2 Recombinant Protein Antigen is derived from E. coli. The AGXT2L2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifica

Gene ID (Entrez) 85007
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name AGXT2L2 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias alanine--glyoxylate aminotransferase 2-like 2, alanine-glyoxylate aminotransferase 2-like 2, EC 2.6.1, EC 2.6.1.-, EC 2.6.1.11, EC 2.6.1.13, EC 2.6.1.44, MGC117348, MGC15875, MGC45484
Gene Symbol AGXT2L2
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52698. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Vedi altri risultati Mostra meno risultati

For Research Use Only.

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.