missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free, Novus Biologicals™

Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18625967 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
Product Code. Quantity unitSize
18625967 20 μg 20µL
18689806 100 μg 100µL
2 options
This item is not returnable. View return policy

Product Code. 18625967

Brand: Novus Biologicals NBP30564020ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Adenine Nucleotide Translocase 1/2/3/4 Polyclonal antibody specifically detects Adenine Nucleotide Translocase 1/2/3/4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Adenine Nucleotide Translocase 1/2/3/4
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias 2F1, AAC1, AAC2, AAC3, AAC4, adenine nucleotide translocase 4, adenine nucleotide translocator 1 (skeletal muscle), adenine nucleotide translocator 2 (fibroblast), Adenine nucleotide translocator 3, Adenine nucleotide translocator 4, ADP,ATP carrier protein 1, ADP,ATP carrier protein 3, ADP,ATP carrier protein 4, ADP,ATP carrier protein, fibroblast isoform, ADP,ATP carrier protein, heart/skeletal muscle, ADP,ATP carrier protein, isoform T2, ADP,ATP carrier protein, liver, ADP/ATP translocase 1, ADP/ATP translocase 2, ADP/ATP translocase 3, ADP/ATP translocase 4, ADP/ATP translocator of liver, ANT, ANT 1, ANT 2, ANT 3, ANT 4, ANT1, ANT2, ANT3, ANT3Y, ANT4, epididymis secretory sperm binding protein, heart/skeletal muscle ATP/ADP translocator, MTDPS12, MTDPS12A, PEO2, PEO3, PEOA2, SFEC35kDa, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4, solute carr
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ANT1 (NP_001142.2). GMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 291
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.