missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Aconitase 1 Polyclonal specifically detects Aconitase 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | Aconitase 1 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | Aconitase, aconitase 1, soluble, aconitate hydratase, Citrate hydro-lyase, cytoplasmic aconitate hydratase, EC 4.2.1, EC 4.2.1.3, Ferritin repressor protein, IREB1IREBP1, IREBP, IRE-BP 1, Iron regulatory protein 1, iron-responsive element binding protein 1, Iron-responsive element-binding protein 1, IRP1ACONS |
| Gene Symbols | ACO1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?