missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myotubularin Antibody [Alexa Fluor« 750], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35068AF750
This item is not returnable.
View return policy
Description
Myotubularin Polyclonal antibody specifically detects Myotubularin in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| Myotubularin | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| Alexa Fluor 750 | |
| CG2, CNM, EC 3.1.3.48, MTMX, myotubular myopathy 1, myotubularin, myotubularin 1, XLMTM | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 484-603 of human Myotubularin (NP_000243.1).,, Sequence:, SARERQKVTERTVSLWSLINSNKEKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDPPTSPSSPSQMMPHVQTHF | |
| 0.1 mL | |
| Protein Phosphatase | |
| 4534 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction