missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCAF Antibody [Alexa Fluor« 488], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35063AF488
This item is not returnable.
View return policy
Description
PCAF Polyclonal antibody specifically detects PCAF in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
| PCAF | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Alexa Fluor 488 | |
| CREBBP-associated factor, EC 2.3.1.48, GCN5L, Histone acetylase PCAF, histone acetyltransferase KAT2B, Histone acetyltransferase PCAF, K(lysine) acetyltransferase 2B, Lysine acetyltransferase 2B, P, P/CAFGCN5, P300/CBP-associated factorCAF, PCAF | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human PCAF (NP_003875.3).,, Sequence:, MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAP | |
| 0.1 mL | |
| Cancer, Cell Cycle and Replication, Cellular Markers, Chromatin Research, HIF Target Genes, Hypoxia, Membrane Trafficking and Chaperones, Signal Transduction, Transcription Factors and Regulators | |
| 8850 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction