missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CYP39A1 Antibody [DyLight 650], Novus Biologicals Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37895C
This item is not returnable.
View return policy
Description
CYP39A1 Polyclonal antibody specifically detects CYP39A1 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| CYP39A1 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot | |
| DyLight 650 | |
| Cytochrome P450 39A1, cytochrome P450, family 39, subfamily A, polypeptide 1, cytochrome P450, subfamily XXXIX (oxysterol 7 alpha-hydroxylase), polypeptide 1,24-hydroxycholesterol 7-alpha-hydroxylase, EC 1.14.13.99, hCYP39A1, oxysterol 7alpha-hydroxylase, Oxysterol 7-alpha-hydroxylase | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP39A1 (NP_057677.2).,, Sequence:, MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNI | |
| 0.1 mL | |
| Cancer, Cardiovascular Biology, Cellular Signaling, metabolism | |
| 51302 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction