missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30499560

CYP39A1 Antibody [DyLight 650], Novus Biologicals Biologicals™

Product Code. 30499560 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30499560 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30499560 Supplier Novus Biologicals Supplier No. NBP337895C

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CYP39A1 Polyclonal antibody specifically detects CYP39A1 in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen CYP39A1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate DyLight 650
Formulation 50mM Sodium Borate
Gene Alias Cytochrome P450 39A1, cytochrome P450, family 39, subfamily A, polypeptide 1, cytochrome P450, subfamily XXXIX (oxysterol 7 alpha-hydroxylase), polypeptide 1,24-hydroxycholesterol 7-alpha-hydroxylase, EC 1.14.13.99, hCYP39A1, oxysterol 7alpha-hydroxylase, Oxysterol 7-alpha-hydroxylase
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP39A1 (NP_057677.2).,, Sequence:, MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNI
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Cardiovascular Biology, Cellular Signaling, metabolism
Primary or Secondary Primary
Gene ID (Entrez) 51302
Target Species Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.