missing translation for 'onlineSavingsMsg'
Learn More

NUCKS1 Antibody [HRP], Novus Biologicals Biologicals™

Product Code. 30498277 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30498277 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30498277

Brand: Novus Biologicals NBP337908H

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

NUCKS1 Polyclonal antibody specifically detects NUCKS1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NUCKS1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate HRP
Formulation PBS
Gene Alias FLJ21480, FLJ32016, FLJ38536, NUCKSnuclear ubiquitous casein and cyclin-dependent kinases substrate, nuclear casein kinase and cyclin-dependent kinase substrate 1, nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate, P1, potential LAG1 interactor
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NUCKS1 (NP_073568.2).,, Sequence:, ASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKE
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64710
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.