missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30498057

SUMO2 Antibody [Alexa Fluor« 594], Novus Biologicals Biologicals™

Product Code. 30498057 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30498057 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30498057

Brand: Novus Biologicals NBP338006AF594

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SUMO2 Polyclonal antibody specifically detects SUMO2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SUMO2
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 594
Formulation 50mM Sodium Borate
Gene Alias HSMT3, MGC117191, sentrin 2, Sentrin-2, small ubiquitin-like modifier 2, small ubiquitin-related modifier 2, SMT3 (suppressor of mif two 3, yeast) homolog 2, SMT3 homolog 2, SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae), SMT3 suppressor of mif two 3 homolog 2 (yeast), SMT3A, SMT3B, SMT3H2, SUMO-2, SUMO3, SUMO-3, Ubiquitin-like protein SMT3A, ubiquitin-like protein SMT3B
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO2 (NP_008868.3).,, Sequence:, MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Epigenetics
Primary or Secondary Primary
Gene ID (Entrez) 6613
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.