missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ TSC22D1 Recombinant Protein
4115.00 NOK - 6245.00 NOK
Specifications
Accession Number | AAH00456 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 8848 |
Molecular Weight (g/mol) | 41.58 |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16192982
|
Abnova™
H00008848-P01.10UG |
10 ug |
4115.00 NOK
10µg |
Estimated Shipment: 18-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16102992
|
Abnova™
H00008848-P01.25UG |
25 ug |
6245.00 NOK
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH00456 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
41.58 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
TSC22D1 | |
Human | |
Recombinant | |
Solution |
Antibody Production, Protein Array, ELISA, Western Blot | |
8848 | |
TSC22D1 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA | |
DKFZp686O19206/MGC17597/RP11-269C23.2/TGFB1I4/TSC22 | |
TSC22D1 | |
Wheat Germ (in vitro) | |
GST |