missing translation for 'onlineSavingsMsg'
Learn More

SULT1C3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09936-100UL

Product Code. 18329385

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

SULT1C3 Polyclonal specifically detects SULT1C3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	SULT1C3
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	EC 2.8.2, EC 2.8.2.1, EC 2.8.2.2, ST1C3, Sulfotransferase 1C3, Sulfotransferase Family, Cytosolic, 1C, Member 3
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human SULT1C3 (NP_001008743). Peptide sequence PTSIMDHSISPFMRKGMPGDWKNYFTVAQNEEFDKDYQKKMAGSTLTFRT
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	442038
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description