Learn More
Abnova™ SECTM1 Recombinant Protein
Human SECTM1 full-length ORF recombinant protein with GST-tag at N-terminal
4115.00 NOK - 6245.00 NOK
Specifications
Accession Number | AAH17716 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 6398 |
Molecular Weight (g/mol) | 49.94 |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16180652
|
Abnova™
H00006398-P01.10UG |
10 ug |
4115.00 NOK
10µg |
Estimated Shipment: 17-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16190652
|
Abnova™
H00006398-P01.25UG |
25 ug |
6245.00 NOK
25µg |
Estimated Shipment: 17-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
- Theoretical MW (kDa): 49.94
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH17716 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
49.94 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
SECTM1 | |
Human | |
Recombinant | |
Solution |
Antibody Production, Protein Array, ELISA, Western Blot | |
6398 | |
SECTM1 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP | |
K12 | |
SECTM1 | |
Wheat Germ (in vitro) | |
GST |