missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ S100A11 (Human) Recombinant Protein
Human S100A11 partial ORF ( AAH14354.1, 10 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00006282-Q01.10ug
Additional Details : Weight : 0.02000kg
Description
- Sequence: TERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGL
Specifications
| AAH14354.1 | |
| S100 calcium binding protein A11 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| S100A11 | |
| GST |
| 6282 | |
| Wheat germ expression system | |
| 10 μg | |
| MLN70, S100C | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |