missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RTEL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10036-25UL
This item is not returnable.
View return policy
Description
RTEL1 Polyclonal specifically detects RTEL1 in Human samples. It is validated for Western Blot.Specifications
| RTEL1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| C20orf41, regulator of telomere elongation helicase 1, regulator of telomere length | |
| The immunogen is a synthetic peptide directed towards the middle region of human RTEL1 (NP_057518.1). Peptide sequence HLNQGRPHLSPRPPPTGDPGSQPQWGSGVPRAGKQGQHAVSAYLADARRA | |
| 25 μg | |
| Cancer, DNA Repair | |
| 51750 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |