missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PHKA1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17109-25UL
This item is not returnable.
View return policy
Description
PHKA1 Polyclonal antibody specifically detects PHKA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
PHKA1 | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
MGC132604, PHKA, phosphorylase b kinase regulatory subunit alpha skeletal muscle isoform, phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform, Phosphorylase kinase alpha M subunit, phosphorylase kinase, alpha 1 (muscle), phosphorylase kinase, alpha 1 (muscle), muscle glycogenosis | |
This antibody was developed against Recombinant Protein corresponding to amino acids: VPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQADILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWG | |
25 μg | |
Cancer, Endocrinology, Neuroscience, Signal Transduction | |
5255 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |