missing translation for 'onlineSavingsMsg'
Learn More

PHKA1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17109-25UL

Product Code. 18329475

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

PHKA1 Polyclonal antibody specifically detects PHKA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	PHKA1
Classification	Polyclonal
Dilution	Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias	MGC132604, PHKA, phosphorylase b kinase regulatory subunit alpha skeletal muscle isoform, phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform, Phosphorylase kinase alpha M subunit, phosphorylase kinase, alpha 1 (muscle), phosphorylase kinase, alpha 1 (muscle), muscle glycogenosis
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: VPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQADILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWG
Quantity	25 μg
Research Discipline	Cancer, Endocrinology, Neuroscience, Signal Transduction
Gene ID (Entrez)	5255
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Description