missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PBX1 (Human) Recombinant Protein

Human PBX1 partial ORF (NP_002576.1, 311 a.a. - 403 a.a.) recombinant protein with GST tag at N-terminal.

Brand:  Abnova™ H00005087-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16024505

  • 5967.00 NOK / 25µg
Estimated Shipment: 26-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: VTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANG
Specifications

Specifications

NP_002576.1
pre-B-cell leukemia homeobox 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PBX1
GST
5087
Wheat germ expression system
25 μg
DKFZp686B09108, MGC126627
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers