missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500154

NRAMP2/SLC11A2/DMT1 Antibody [mFluor Violet 500 SE], Novus Biologicals Biologicals™

Product Code. 30500154 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500154 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500154 Supplier Novus Biologicals Supplier No. NBP335108MFV500

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NRAMP2/SLC11A2/DMT1 Polyclonal antibody specifically detects NRAMP2/SLC11A2/DMT1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen NRAMP2/SLC11A2/DMT1
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate mFluor Violet 500 SE
Formulation 50mM Sodium Borate
Gene Alias DCT1NRAMP 2, Divalent cation transporter 1, Divalent metal transporter 1, DMT-1, DMT1FLJ37416, member 2, NRAMP2natural resistance-associated macrophage protein 2, solute carrier family 11 (proton-coupled divalent metal ion transporters)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human NRAMP2/SLC11A2/DMT1 (NP_001167597.1).,, Sequence:, MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYS
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4891
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.