missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF44 Partial ORF (NP_057348.2, 1 a.a. - 103 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051710-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137246

  • 5420.23 NOK / 25µg

Estimated Shipment: 21-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVNFTHEEWALLGPSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQ
Specifications

Specifications

NP_057348.2
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.07kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVNFTHEEWALLGPSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQ
RUO
ZNF44
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
51710
ZNF44 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp434F1811/DKFZp686L21136/GIOT-2/KOX7/ZNF/ZNF504/ZNF55/ZNF58
ZNF44
Yes
Videos
SDS
Documents
Certificates