Learn More
Abnova™ Human ZNF14 Partial ORF (NP_066358, 70 a.a. - 161 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007561-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins. [provided by RefSeq]
Sequence: RLCESRRGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFIHHSSLNRHMRSHTGQKPNEYQEYEKQPCKCKAVGKTFSYHHCFRKHERSpecifications
NP_066358 | |
Liquid | |
7561 | |
ZNF14 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
GIOT-4/KOX6 | |
ZNF14 | |
Yes | |
wheat germ expression system |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.86kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
RLCESRRGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFIHHSSLNRHMRSHTGQKPNEYQEYEKQPCKCKAVGKTFSYHHCFRKHER | |
RUO | |
ZNF14 | |
Wheat Germ (in vitro) | |
GST |