missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF14 Partial ORF (NP_066358, 70 a.a. - 161 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007561-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137705

  • 3602.46 NOK / 10µg

Estimated Shipment: 21-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins. [provided by RefSeq]

Sequence: RLCESRRGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFIHHSSLNRHMRSHTGQKPNEYQEYEKQPCKCKAVGKTFSYHHCFRKHER
Specifications

Specifications

NP_066358
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.86kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RLCESRRGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFIHHSSLNRHMRSHTGQKPNEYQEYEKQPCKCKAVGKTFSYHHCFRKHER
RUO
ZNF14
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
7561
ZNF14 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GIOT-4/KOX6
ZNF14
Yes
Videos
SDS
Documents
Certificates