missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ZIC4 Partial ORF (NP_115529, 249 a.a. - 319 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4115.00 NOK - 6245.00 NOK
Specifications
Accession Number | NP_115529 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 84107 |
Molecular Weight (g/mol) | 33.55kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16190627
|
Abnova™
H00084107-Q01.25UG |
25 ug |
6245.00 NOK
25µg |
Estimated Shipment: 14-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16180627
|
Abnova™
H00084107-Q01.10UG |
10 ug |
4115.00 NOK
10µg |
Estimated Shipment: 14-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function. [provided by RefSeq]
Sequence: SDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQVSpecifications
NP_115529 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.55kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ42609/FLJ45833 | |
ZIC4 | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
84107 | |
ZIC4 (Human) Recombinant Protein (Q01) | |
SDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQV | |
RUO | |
ZIC4 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |