missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TNFRSF10D Partial ORF (NP_003831, 56 a.a. - 145 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008793-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139265

  • 4130.00 NOK / 10µg
Estimated Shipment: 01-12-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis. [provided by RefSeq]

Sequence: ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGS
Specifications

Specifications

NP_003831
Liquid
8793
TNFRSF10D (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD264/DCR2/TRAILR4/TRUNDD
TNFRSF10D
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGS
RUO
TNFRSF10D
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers