missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TLN1 Partial ORF (AAH42923.1, 1324 a.a. - 1424 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007094-Q03.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16004895

  • 3348.63 NOK / 10µg


Estimated Shipment
17-11-2020
Add to basket

Description

Description

Sequence: TDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGD
Specifications

Specifications

AAH42923
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue
TDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGD
RUO
TLN1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
7094
TLN1 (Human) Recombinant Protein (Q03)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ILWEQ|KIAA1027|TLN
TLN1
Yes
Videos
Documents