missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TCL1A Partial ORF (AAH03574.1, 7 a.a. - 102 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008115-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16024985

  • 5967.00 NOK / 25µg
Estimated Shipment: 26-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: LGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDG
Specifications

Specifications

AAH03574.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.286kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDG
RUO
TCL1A
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
8115
TCL1A (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TCL1
TCL1A
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers