missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TBX18 Partial ORF (XP_496819.1, 454 a.a. - 560 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009096-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16005135

  • 5078.48 NOK / 25µg


Estimated Shipment
13-11-2020
Add to basket

Description

Description

Sequence: STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
Specifications

Specifications

XP_496819.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.4kDa
12.5% SDS-PAGE Stained with Coomassie Blue
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
RUO
TBX18
Yes
wheat germ expression system
Liquid
9096
TBX18 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TBX18
Wheat Germ (in vitro)
GST
Videos
Documents