missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SSRP1 Partial ORF (NP_003137.1, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006749-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135905

  • 3602.46 NOK / 10µg

Estimated Shipment: 10-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a subunit of a heterodimer that, along with SUPT16H, forms chromatin transcriptional elongation factor FACT. FACT interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT and cisplatin-damaged DNA may be crucial to the anticancer mechanism of cisplatin. This encoded protein contains a high mobility group box which most likely constitutes the structure recognition element for cisplatin-modified DNA. This protein also functions as a co-activator of the transcriptional activator p63. An alternatively spliced transcript variant of this gene has been described, but its full-length nature is not known. [provided by RefSeq]

Sequence: MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGHGLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEK
Specifications

Specifications

NP_003137.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGHGLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEK
RUO
SSRP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6749
SSRP1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FACT/FACT80/T160
SSRP1
Yes
Videos
SDS
Documents
Certificates