missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human Slc1A5 Full-Length Orf (No Protein_Acc, 1 A.A.-493 A.A.) Recombinant Protein With Gst Tag At N-Terminal.
Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.
4115.00 NOK - 6245.00 NOK
Specifications
| Accession Number | no protein_acc |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 6510 |
| Name | SLC1A5 (Human) Recombinant Protein (P01) |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16115355
|
Abnova™
H00006510-P01.10UG |
10 ug |
4115.00 NOK
10µg |
Estimated Shipment: 11-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16125355
|
Abnova™
H00006510-P01.25UG |
25 ug |
6245.00 NOK
25µg |
Estimated Shipment: 11-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Good Folding
- Excellent amino acids labeling
Immunogen Sequence: MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVVCSLIGGAASLDPGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPS
Specifications
| no protein_acc | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| SLC1A5 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AAAT/ASCT2/ATBO/FLJ31068/M7V1/M7VS1/R16/RDRC | |
| SLC1A5 | |
| Liquid |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 6510 | |
| Glutathione Sepharose 4 Fast Flow | |
| MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVVCSLIGGAASLDPGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIVEMEDVGLLFARLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGTSSSSATLPLMMKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVTATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM | |
| RUO | |
| SLC1A5 | |
| GST |
For Research Use Only