missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC18A3 Partial ORF (NP_003046, 476 a.a. - 532 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00006572-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene. [provided by RefSeq]
Sequence: TRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDECEDDYNYYYTRSSpecifications
| NP_003046 | |
| Liquid | |
| 6572 | |
| SLC18A3 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC12716/VACHT | |
| SLC18A3 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.01kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| TRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDECEDDYNYYYTRS | |
| RUO | |
| SLC18A3 | |
| Wheat Germ (in vitro) | |
| GST |