missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC11A1 Partial ORF (NP_000569.2, 308 a.a. - 350 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4115.00 NOK - 6245.00 NOK
Specifications
| Accession Number | NP_000569.2 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 6556 |
| Molecular Weight (g/mol) | 30.47kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16115425
|
Abnova™
H00006556-Q01.10UG |
10 ug |
4115.00 NOK
10µg |
Estimated Shipment: 17-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16125425
|
Abnova™
H00006556-Q01.25UG |
25 ug |
6245.00 NOK
25µg |
Estimated Shipment: 17-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq]
Sequence: QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGVSpecifications
| NP_000569.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 30.47kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| LSH/NRAMP/NRAMP1 | |
| SLC11A1 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 6556 | |
| SLC11A1 (Human) Recombinant Protein (Q01) | |
| QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV | |
| RUO | |
| SLC11A1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |