missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SF3A2 Partial ORF (NP_009096, 112 a.a. - 216 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00008175-Q01.2ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes subunit 2 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 2 interacts with subunit 1 through its amino-terminus while the single zinc finger domain of subunit 2 plays a role in its binding to the 15S U2 snRNP. Subunit 2 may also function independently of its RNA splicing function as a microtubule-binding protein. [provided by RefSeq]
Sequence: IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKSpecifications
| NP_009096 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.29kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 2 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PRP11/PRPF11/SAP62/SF3a66 | |
| SF3A2 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 8175 | |
| SF3A2 (Human) Recombinant Protein (Q01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEK | |
| RUO | |
| SF3A2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |