missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SCAND2 Partial ORF (NP_071333, 1 a.a. - 62 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00054581-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16005545

  • 5078.48 NOK / 25µg


Estimated Shipment
17-11-2020
Add to basket

Description

Description

Sequence: MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPREA
Specifications

Specifications

NP_071333
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.56kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPREA
RUO
SCAND2
Yes
wheat germ expression system
Liquid
54581
SCAND2 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SCAND2
Wheat Germ (in vitro)
GST
Videos
Documents