missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RPA3 Partial ORF (AAH05264, 12 a.a. - 121 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006119-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134515

  • 3602.46 NOK / 10µg

Estimated Shipment: 10-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: INAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD
Specifications

Specifications

AAH05264
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
INAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD
RUO
RPA3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6119
RPA3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
REPA3
RPA3
Yes
Videos
SDS
Documents
Certificates