missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RORB Partial ORF (NP_008845, 136 a.a. - 224 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006096-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16194485

  • 3655.00 NOK / 10µg
Estimated Shipment: 23-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation. [provided by RefSeq]

Sequence: ETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHL
Specifications

Specifications

NP_008845
Liquid
6096
RORB (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NR1F2/ROR-BETA/RZR-BETA/RZRB/bA133M9.1
RORB
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.53kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHL
RUO
RORB
Wheat Germ (in vitro)
GST
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers