missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RGC32 Partial ORF (NP_054778.1, 1 a.a. - 117 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00028984-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16025455

  • 5967.00 NOK / 25µg
Estimated Shipment: 03-02-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression. [provided by RefSeq]

Sequence: MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM
Specifications

Specifications

NP_054778.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
38.61kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM
RUO
C13orf15
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
28984
RGC32 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0564/MGC87338/RGC-32/RGC32/bA157L14.2
C13orf15
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers