missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RCVRN Partial ORF (NP_002894.1, 3 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005957-Q04.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16004675

  • 5078.48 NOK / 25µg


Estimated Shipment
23-11-2020
Add to basket

Description

Description

Sequence: NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTN
Specifications

Specifications

NP_002894.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.3kDa
12.5% SDS-PAGE Stained with Coomassie Blue
NSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTN
RUO
RCVRN
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5957
RCVRN (Human) Recombinant Protein (Q04)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RCV1
RCVRN
Yes
Videos
SDS
Documents