missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human Rax Partial Orf (Np_038463.2, 104 A.A.-206 A.A.) Recombinant Protein With Gst Tag At N-Terminal.

Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.

Brand:  Abnova™ H00030062-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16005485

  • 3348.63 NOK / 10µg


Estimated Shipment
13-11-2020
Add to basket

Description

Description

  • Good Folding
  • Excellent amino acids labeling

Immunogen Sequence: KEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQD

Specifications

Specifications

NP_038463.2
Liquid
30062
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MCOP3|RX
RAX
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
RAX (Human) Recombinant Protein (Q01)
12.5% SDS-PAGE Stained with Coomassie Blue
KEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQD
RUO
RAX
GST
Videos
Documents

For Research Use Only